PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10030663
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 184aa    MW: 20203 Da    PI: 6.2755
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10030663genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF741.2e-231765149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 k+i n s  qvtfskRr+g++KKA+EL++LC++e+avi+fs+ gk y +
  Lus10030663 17 KKILNRSHLQVTFSKRRAGLFKKASELCTLCGVEIAVIVFSPAGKTYSF 65
                 678899***************************************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-27968IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.035969IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-171131IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-241281IPR002100Transcription factor, MADS-box
CDDcd002656.40E-321284No hitNo description
PfamPF003193.8E-251865IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-173146IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-174667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MANNKPSNNS PQKLPIKKIL NRSHLQVTFS KRRAGLFKKA SELCTLCGVE IAVIVFSPAG  60
KTYSFGHSDV VSIVRKFLTT AASHPPSVEA PSQITPEARE LNAELNAELT LVLSELEVER  120
KQGELLDRMV KAQEAEYGLS IADLGLDGLA QLRNALEELQ LNVENQKISV GYEYGNFSEN  180
WSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011088151.17e-49PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A0B2QP356e-47A0A0B2QP35_GLYSO; Agamous-like MADS-box protein AGL62
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12833331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.13e-27AGAMOUS-like 61